A3625
PKD2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3625
- Additional Names:
- APKD2|Pc-2|PC2|PKD2|PKD4|TRPP2
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV
- Uniprot:
- Q13563
- Synonyms:
- APKD2;autosomal dominant polycystic kidney disease type II protein;Pc-2;PC2;PKD4;polycystic kidney disease 2 (autosomal dominant);Polycystic kidney disease 2 protein;polycystin-2;Polycystwin;R48321;transient receptor potential cation channel subfamily P member 2;TRPP2
- Extra Details:
- This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.
- Shipping Conditions:
- Blue Ice

