[KD Validated] SIRT6 Rabbit monoclonal antibody

Size

POA

SKU:: A3591
Additional Names:: hSIRT6|SIR2L6|SIRT6
Application:: ELISA, WB
Molecular Weight:: 42 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS
Uniprot:: Q8N6T7
Synonyms:: NAD-dependent protein deacetylase sirtuin-6;regulatory protein SIR2 homolog 6;SIR2-like protein 6;sir2-related protein type 6;SIR2L6;sirtuin type 6
Extra Details:: This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase and histone deacetylase activities, and plays a role in DNA repair, maintenance of telomeric chromatin, inflammation, lipid and glucose metabolism. Alternative splicing results in multiple transcript variants encoding different isoforms.