A3583
CDC16 Rabbit monoclonal antibody
Size
POA
- SKU:
- A3583
- Additional Names:
- ANAPC6|APC6|CDC16|CDC16Hs|CUT9
- Application:
- ELISA, IHC-P, IF, ICC
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
- Uniprot:
- Q13042
- Synonyms:
- ANAPC6;Anaphase-promoting complex subunit 6;anaphase-promoting complex, subunit 6;APC6;CDC16 homolog;CDC16Hs;cell division cycle 16 homolog;cell division cycle protein 16 homolog;CUT9;cyclosome subunit 6
- Extra Details:
- The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified.
- Shipping Conditions:
- Blue Ice