[KO Validated] NRF2 Rabbit monoclonal antibody

Size

POA

SKU:: A3577
Additional Names:: F2|HEBP1|IMDDHH|Nrf-2|NRF2
Application:: ChIP, ELISA, WB, IP
Molecular Weight:: 103kDa/97-100 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN
Uniprot:: Q16236
Synonyms:: HEBP1;IMDDHH;Nrf-2;NRF2;nuclear factor erythroid 2-related factor 2;nuclear factor erythroid-derived 2-like 2;Nuclear factor, erythroid derived 2, like 2
Extra Details:: This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene.