SMC4 Rabbit monoclonal antibody

Size

POA

SKU:: A3559
Additional Names:: CAP-C|CAPC|SMC-4|SMC4|SMC4L1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 180kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGIYKTYNITKSVAVNPKEIASKGLC
Uniprot:: Q9NTJ3
Synonyms:: CAP-C;CAPC;chromosome-associated polypeptide C;SMC protein 4;SMC-4;SMC4 structural maintenance of chromosomes 4-like 1;SMC4L1;structural maintenance of chromosomes protein 4;XCAP-C homolog
Extra Details:: This gene belongs to the 'structural maintenance of chromosomes' (SMC) gene family. Members of this gene family play a role in two changes in chromosome structure during mitotic segregation of chromosomes- chromosome condensation and sister chromatid cohesion. The protein encoded by this gene is likely a subunit of the 13S condensin complex, which is involved in chromosome condensation. A pseudogene related to this gene is located on chromosome 2.