Complement C4A Rabbit monoclonal antibody

Size

POA

SKU:: A3545
Additional Names:: C4|C4A2|C4A3|C4A4|C4A6|C4AD|C4S|CO4|Complement C4A|CPAMD2|RG
Application:: ELISA, WB, IF
Molecular Weight:: 210 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQ
Uniprot:: P0C0L4
Synonyms:: acidic C4;acidic complement C4;basic complement C4;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3;C4;C4A anaphylatoxin;C4A2;C4A3;C4A4;C4A6;C4AD;C4B_2;C4B1;C4B12;C4B2;C4B3;C4B5;C4BD;C4F;C4S;CH;Chido form of C4;CO4;complement C4-A;complement C4-B;complement C4B1a;complement component 4A (Rodgers blood group);complement component 4B (Chido blood group);CPAMD2;CPAMD3;MHC class III region complement;RG;Rodgers form of C4
Extra Details:: This gene encodes the acidic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus and type I diabetes mellitus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. Two transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice