NEK6 Rabbit monoclonal antibody

Size

POA

SKU:: A3536
Additional Names:: NEK6|SID6-1512
Application:: ELISA, WB, IHC-P
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
Uniprot:: Q9HC98
Synonyms:: never in mitosis A-related kinase 6;NIMA (never in mitosis gene a)-related kinase 6;nimA-related protein kinase 6;protein kinase SID6-1512;putative serine-threonine protein kinase;serine/threonine-protein kinase Nek6;SID6-1512
Extra Details:: The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene.