A3534
YB-1/YBX1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A3534
- Additional Names:
- BP-8|CBF-A|CSDA2|CSDB|DBPB|EFI-A|MDR-NF1|NSEP-1|NSEP1|YB-1|YB-1/YBX1|YB1
- Application:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molecular Weight:
- 49 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
- Uniprot:
- P67809
- Synonyms:
- BP-8;CBF-A;CCAAT-binding transcription factor I subunit A;CSDA2;CSDB;DBPB;DNA-binding protein B;EFI-A;enhancer factor I subunit A;major histocompatibility complex, class II, Y box-binding protein I;MDR-NF1;NSEP-1;NSEP1;nuclease-sensitive element-binding protein 1;Y-box transcription factor;Y-box-binding protein 1;YB-1;YB1
- Extra Details:
- This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes.
- Shipping Conditions:
- Blue Ice