A3501
OGT Rabbit monoclonal antibody
Size
POA
- SKU:
- A3501
- Additional Names:
- HINCUT-1|HRNT1|MRX106|O-GLCNAC|OGT|OGT1|XLID106
- Application:
- ChIP, ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA
- Uniprot:
- O15294
- Synonyms:
- HINCUT-1;HRNT1;MRX106;O-GLCNAC;O-GlcNAc transferase p110 subunit;O-GlcNAc transferase subunit p110;O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase);O-linked N-acetylglucosamine transferase 110 kDa subunit;OGT1;UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit;UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase;uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase;XLID106
- Extra Details:
- This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice