VIPAS39 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3479
Additional Names:: C14orf133|hSPE-39|SPE-39|SPE39|VIPAR|VIPAS39|VPS16B
Application:: ELISA, WB
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVR
Uniprot:: Q9H9C1
Synonyms:: C14orf133;hSPE-39;SPE-39;SPE39;spermatogenesis-defective protein 39 homolog;VIPAR;VPS16B;VPS33B-interacting protein in apical-basolateral polarity regulator;VPS33B-interacting protein in polarity and apical restriction;VPS33B-interacting protein involved in polarity and apical protein restriction
Extra Details:: Involved in endosome to lysosome transport and intracellular protein transport. Acts upstream of or within collagen metabolic process and peptidyl-lysine hydroxylation. Located in Golgi apparatus and endosome. Implicated in arthrogryposis, renal dysfunction, and cholestasis 2.