PSMA1 Rabbit monoclonal antibody

Size

POA

SKU:: A3460
Additional Names:: HC2|HEL-S-275|NU|PROS30|PSMA1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Uniprot:: P25786
Synonyms:: 30 kDa prosomal protein;epididymis secretory protein Li 275;HC2;HEL-S-275;macropain subunit C2;macropain subunit nu;multicatalytic endopeptidase complex subunit C2;NU;PROS-30;PROS30;proteasome (prosome, macropain) subunit, alpha type, 1;proteasome component C2;proteasome nu chain;proteasome subunit alpha 1;proteasome subunit alpha 6;proteasome subunit alpha type-1;proteasome subunit nu;proteasome subunit, alpha-type, 1;protein P30-33K;testicular tissue protein Li 150
Extra Details:: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Shipping Conditions:: Blue Ice