[KO Validated] TBK1/NAK Rabbit monoclonal antibody

Size

POA

SKU:: A3458
Additional Names:: FTDALS4|IIAE8|NAK|T2K|TBK1/NAK
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 84kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE
Uniprot:: Q9UHD2
Synonyms:: FTDALS4;IIAE8;NAK;NF-kappa-B-activating kinase;NF-kB-activating kinase;serine/threonine-protein kinase TBK1;T2K;TANK-binding kinase 1
Extra Details:: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. The protein is also an important kinase for antiviral innate immunity response.