PON1 Rabbit monoclonal antibody

Size

POA

SKU:: A3441
Additional Names:: ESA|MVCD5|PON|PON1
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEE
Uniprot:: P27169
Synonyms:: A-esterase 1;aromatic esterase 1;arylesterase 1;arylesterase B-type;ESA;esterase A;K-45;MVCD5;paraoxonase B-type;PON;PON 1;serum aryldiakylphosphatase;serum aryldialkylphosphatase 1;serum paraoxonase/arylesterase 1
Extra Details:: This gene encodes a member of the paraoxonase family of enzymes and exhibits lactonase and ester hydrolase activity. Following synthesis in the kidney and liver, the enzyme is secreted into the circulation, where it binds to high density lipoprotein (HDL) particles and hydrolyzes thiolactones and xenobiotics, including paraoxon, a metabolite of the insecticide parathion. Polymorphisms in this gene may be associated with coronary artery disease and diabetic retinopathy. The gene is found in a cluster of three related paraoxonase genes on chromosome 7.