C14orf166 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3436
Additional Names:: C14orf166|CGI-99|CGI99|CLE|CLE7|hCLE|hCLE1|LCRP369|RLLM1
Application:: ELISA, WB
Molecular Weight:: 25kDa/28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
Uniprot:: Q9Y224
Synonyms:: C14orf166;CGI-99;CGI99;CLE;CLE7;CLE7 homolog;hCLE;hCLE1;LCRP369;RLL motif containing 1;RLLM1;RNA transcription, translation and transport factor protein;UPF0568 protein C14orf166
Extra Details:: Enables RNA binding activity; RNA polymerase II complex binding activity; and identical protein binding activity. Involved in negative regulation of protein kinase activity; positive regulation of transcription by RNA polymerase II; and tRNA splicing, via endonucleolytic cleavage and ligation. Located in microtubule cytoskeleton; nucleoplasm; and perinuclear region of cytoplasm. Part of tRNA-splicing ligase complex.