A3361
c-Maf Rabbit monoclonal antibody
Size
POA
- SKU:
- A3361
- Additional Names:
- AYGRP|c-MAF|CCA4|CTRCT21
- Application:
- ELISA, WB
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFM
- Uniprot:
- O75444
- Synonyms:
- Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene;AYGRP;c-MAF;c-maf proto-oncogene;CCA4;CTRCT21;proto-oncogene c-Maf;T lymphocyte c-maf long form;transcription factor Maf;v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog;V-maf musculoaponeurotic fibrosarcoma oncogene homolog
- Extra Details:
- The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice