CDC27 Rabbit monoclonal antibody

Size

POA

SKU:: A3333
Additional Names:: ANAPC3|APC3|CDC27|CDC27Hs|D0S1430E|D17S978E|H-NUC|HNUC|NUC2
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
Uniprot:: P30260
Synonyms:: ANAPC3;anaphase promoting complex subunit 3;Anaphase-promoting complex subunit 3;anaphase-promoting complex, protein 3;APC3;CDC27 homolog;CDC27Hs;cell division cycle 27 homolog;cell division cycle protein 27 homolog;D0S1430E;D0S1430E, D17S978E;D17S978E;H-NUC;HNUC;NUC2;nuc2 homolog
Extra Details:: The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of the anaphase-promoting complex (APC), which is composed of eight protein subunits and is highly conserved in eukaryotic cells. This complex catalyzes the formation of cyclin B-ubiquitin conjugate, which is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. The protein encoded by this gene and three other members of the APC complex contain tetratricopeptide (TPR) repeats, which are important for protein-protein interactions. This protein was shown to interact with mitotic checkpoint proteins including Mad2, p55CDC and BUBR1, and it may thus be involved in controlling the timing of mitosis. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 22 and Y.

Shipping Conditions:: Blue Ice