A3308
Mineralocorticoid receptor (NR3C2) Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A3308
- Additional Names:
- MCR|Mineralocorticoid receptor (NR3C2)|MLR|MR|NR3C2VIT
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
- Uniprot:
- P08235
- Synonyms:
- aldosterone receptor;MCR;mineralocorticoid receptor;mineralocorticoid receptor 1;mineralocorticoid receptor 2;mineralocorticoid receptor delta;MLR;MR;NR3C2VIT;Nuclear receptor subfamily 3 group C member 2;nuclear receptor subfamily 3, group C, member 2 variant 3
- Extra Details:
- This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice