INPP5A Rabbit polyclonal antibody

Size

£152.00

SKU:: A3302
Additional Names:: 5PTASE|INPP5A
Application:: ELISA, WB
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPS
Uniprot:: Q14642
Synonyms:: 43 kDa inositol polyphosphate 5-phophatase;43 kDa inositol polyphosphate 5-phosphatase;5PTASE;CTCL tumor antigen HD-CL-02;inositol polyphosphate-5-phosphatase A;inositol polyphosphate-5-phosphatase, 40kD;inositol polyphosphate-5-phosphatase, 40kDa;inositol trisphosphate-5-phosphatase, 40kD;InsP3 5-phosphatase;type I inositol 1,4,5-trisphosphate 5-phosphatase;type I inositol-1,4,5-trisphosphate 5-phophatase
Extra Details:: The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.