A3294
CBX2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A3294
- Additional Names:
- CBX2|CDCA6|M33|SRXY5
- Application:
- ELISA, WB
- Molecular Weight:
- 56kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY
- Uniprot:
- Q14781
- Synonyms:
- CDCA6;cell division cycle associated 6;chromobox homolog 2 (Pc class homolog, Drosophila);chromobox protein homolog 2;M33;modifier 3;Pc class homolog;SRXY5
- Extra Details:
- This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
- Shipping Conditions:
- Blue Ice