CNGA3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3288
Additional Names:: ACHM2|CCNC1|CCNCa|CCNCalpha|CNCG3|CNG3|CNGA3
Application:: ELISA, WB
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS
Uniprot:: Q16281
Synonyms:: ACHM2;CCNC1;CCNCa;CCNCalpha;CNCG3;CNG channel alpha-3;CNG-3;CNG3;cone photoreceptor cGMP-gated channel alpha subunit;cone photoreceptor cGMP-gated channel subunit alpha;cyclic nucleotide gated channel alpha 3;cyclic nucleotide-gated cation channel alpha-3;Cyclic nucleotide-gated channel alpha-3
Extra Details:: This gene encodes a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in this gene are associated with achromatopsia (rod monochromacy) and color blindness. Two alternatively spliced transcripts encoding different isoforms have been described.