A3259
WDR5 Rabbit monoclonal antibody

Size
POA
- SKU:
- A3259
- Additional Names:
- BIG-3|BIG3|CFAP89|SWD3|WDR5
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
- Uniprot:
- P61964
- Synonyms:
- BIG-3;BIG3;BMP2-induced 3-kb gene protein;CFAP89;cilia and flagella associated protein 89;SWD3;SWD3, Set1c WD40 repeat protein, homolog;WD repeat-containing protein 5
- Extra Details:
- This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.
- Shipping Conditions:
- Blue Ice

