EGR2 Rabbit monoclonal antibody

Size

POA

SKU:: A3219
Additional Names:: AT591|CMT1D|CMT4E|EGR2|KROX20
Application:: ELISA, WB, IP
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDP
Uniprot:: P11161
Synonyms:: AT591;CHN1;CMT1D;CMT4E;E3 SUMO-protein ligase EGR2;E3 SUMO-protein transferase ERG2;early growth response protein 2;KROX-20, Drosophila, homolog (early growth response-2);KROX20;zinc finger protein Krox-20
Extra Details:: The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.