NDUFA9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3196
Additional Names:: CC6|CI-39k|CI39k|COQ11|MC1DN26|NDUFA9|NDUFS2L|SDR22E1
Application:: ELISA, WB
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSR
Uniprot:: Q16795
Synonyms:: CC6;CI-39k;CI-39kD;CI39k;complex I 39kDa subunit;Complex I-39kD;COQ11;MC1DN26;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa;NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial;NADH-ubiquinone oxidoreductase 39 kDa subunit;NDUFS2L;SDR22E1;short chain dehydrogenase/reductase family 22E, member 1
Extra Details:: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12.

Shipping Conditions:: Blue Ice