A3183
PTHLH Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3183
- Additional Names:
- BDE2|HHM|PLP|PTHLH|PTHR|PTHRP
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR
- Uniprot:
- P12272
- Synonyms:
- BDE2;HHM;osteostatin;parathyroid hormone-like hormone preproprotein;Parathyroid hormone-like protein;parathyroid hormone-like related protein;parathyroid hormone-related protein;PLP;PTH-related protein;PTH-rP;PTHR;PTHRP
- Extra Details:
- The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone.
- Shipping Conditions:
- Blue Ice








