A3135
Somatostatin Receptor 2 (SSTR2) Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A3135
- Additional Names:
- Somatostatin Receptor 2 (SSTR2)|SST2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 87kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
- Uniprot:
- P30874
- Synonyms:
- somatostatin receptor type 2;SRIF-1;SS2R
- Extra Details:
- Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney.
- Shipping Conditions:
- Blue Ice