SFTPA1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3133
Additional Names:: COLEC4|ILD1|PSAP|PSP-A|PSPA|SFTP1|SFTPA1|SFTPA1B|SP-A|SP-A1|SP-A1 beta|SP-A1 delta|SP-A1 epsilon|SP-A1 gamma|SPA|SPA1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGK
Uniprot:: Q8IWL2
Synonyms:: 35 kDa pulmonary surfactant-associated protein;alveolar proteinosis protein;COLEC4;collectin-4;PSAP;PSP-A;PSPA;pulmonary surfactant-associated protein A1;SFTP1;SFTPA1B;SP-A;SP-A1;SP-A1 beta;SP-A1 delta;SP-A1 epsilon;SP-A1 gamma;SPA;SPA1;surfactant protein A1B;surfactant, pulmonary-associated protein A1A;surfactant, pulmonary-associated protein A1B
Extra Details:: This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice