A3122
PP2A Catalytic B Beta Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A3122
- Additional Names:
- PP2A Catalytic B Beta|PP2Abeta|PP2CB
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
- Uniprot:
- P62714
- Synonyms:
- PP2A-beta;PP2Abeta;PP2CB;protein phosphatase 2, catalytic subunit, beta isozyme;protein phosphatase type 2A catalytic subunit;serine/threonine-protein phosphatase 2A catalytic subunit beta isoform;testicular tissue protein Li 146
- Extra Details:
- This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit.
- Shipping Conditions:
- Blue Ice