A3118
ENO2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A3118
- Additional Names:
- ENO2|HEL-S-279|NSE
- Application:
- ELISA, WB
- Molecular Weight:
- 47kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERE
- Uniprot:
- P09104
- Synonyms:
- 2-phospho-D-glycerate hydro-lyase;2-phospho-D-glycerate hydrolyase;Enolase 2;enolase 2 (gamma, neuronal);epididymis secretory protein Li 279;gamma-enolase;HEL-S-279;neural enolase;neuron specific gamma enolase;neuron-specific enolase;neuronal enriched enolase;neurone-specific enolase;NSE
- Extra Details:
- This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
- Shipping Conditions:
- Blue Ice