A3113
OPRL1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A3113
- Additional Names:
- KOR-3|KOR3|NOCIR|NOP|NOPr|OOR|OPRL|OPRL1|ORL1|PNOCR
- Application:
- ELISA, WB
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AVFVGCWTPVQVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALACKTSETVPRPA
- Uniprot:
- P41146
- Synonyms:
- kappa-type 3 opioid receptor;kappa3-related opioid receptor;KOR-3;KOR3;nociceptin receptor;nociceptin/orphanin FQ receptor;NOCIR;NOP;NOPr;OOR;opiate receptor-like 1;OPRL;ORL1;orphanin FQ receptor;PNOCR
- Extra Details:
- The protein encoded by this gene is a member of the 7 transmembrane-spanning G protein-coupled receptor family, and functions as a receptor for the endogenous, opioid-related neuropeptide, nociceptin/orphanin FQ. This receptor-ligand system modulates a variety of biological functions and neurobehavior, including stress responses and anxiety behavior, learning and memory, locomotor activity, and inflammatory and immune responses. A promoter region between this gene and the 5'-adjacent RGS19 (regulator of G-protein signaling 19) gene on the opposite strand functions bi-directionally as a core-promoter for both genes, suggesting co-operative transcriptional regulation of these two functionally related genes. Alternatively spliced transcript variants have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
- Shipping Conditions:
- Blue Ice