A3109
Alpha Internexin Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3109
- Additional Names:
- Alpha Internexin|NEF5|NF-66|NF66|TXBP-1
- Application:
- ELISA, WB
- Molecular Weight:
- 65kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
- Uniprot:
- Q16352
- Synonyms:
- 66 kDa neurofilament protein;alpha-internexin;alpha-Inx;NEF5;Neurofilament 5;neurofilament 5 (66kD);neurofilament-66, tax-binding protein;NF-66;NF66;TXBP-1
- Extra Details:
- Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
- Shipping Conditions:
- Blue Ice

