A3100
SUMO4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A3100
- Additional Names:
- dJ281H8.4|IDDM5|SMT3H4|SUMO-4|SUMO4
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
- Uniprot:
- Q6EEV6
- Synonyms:
- dJ281H8.4;IDDM5;insulin-dependent diabetes mellitus 5;small ubiquitin-like modifier 4 protein;Small ubiquitin-like protein 4;small ubiquitin-related modifier 4;SMT3 suppressor of mif two 3 homolog 2;SMT3 suppressor of mif two 3 homolog 4;SMT3H4;SUMO-4
- Extra Details:
- This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism.
- Shipping Conditions:
- Blue Ice