A3092
HNF1A Alpha Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3092
- Additional Names:
- HNF-1-alpha|HNF-1A|HNF1|HNF1alpha|HNF1A Alpha|HNF4A|IDDM20|LFB1|MODY3|TCF-1|TCF1
- Application:
- ELISA, WB
- Molecular Weight:
- 81kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQ
- Uniprot:
- P20823
- Synonyms:
- albumin proximal factor;hepatic nuclear factor 1;hepatocyte nuclear factor 1-alpha;HNF-1-alpha;HNF-1A;HNF1;HNF1alpha;HNF4A;IDDM20;interferon production regulator factor;LFB1;liver-specific transcription factor LF-B1;MODY3;TCF-1;TCF1;Transcription factor 1;transcription factor 1, hepatic;truncated hepatocyte nuclear factor 1 alpha
- Extra Details:
- The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice

