SLC1A4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3084
Additional Names:: ASCT1|SATT|SLC1A4|SPATCCM
Application:: ELISA, WB, IHC-P
Molecular Weight:: 60-80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ELNAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNC
Uniprot:: P43007
Synonyms:: alanine/serine/cysteine/threonine transporter 1;ASCT1;glutamate/neutral amino acid transporter;neutral amino acid transporter A;SATT;solute carrier family 1 (glutamate/neutral amino acid transporter), member 4;Solute carrier family 1 member 4;SPATCCM
Extra Details:: The protein encoded by this gene is a sodium-dependent neutral amino acid transporter for alanine, serine, cysteine, and threonine. Defects in this gene have been associated with developmental delay, microcephaly, and intellectual disability.