PDK4 Rabbit polyclonal antibody

Size

POA

SKU:: A3069
Additional Names:: PDK4
Application:: ELISA, WB, IHC-P
Molecular Weight:: 46kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: STAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
Uniprot:: Q16654
Synonyms:: [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial;[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial;Pyruvate dehydrogenase kinase isoform 4;pyruvate dehydrogenase kinase, isoenzyme 4;pyruvate dehydrogenase kinase, isozyme 4;pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial
Extra Details:: This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.