PARD6A Rabbit polyclonal antibody

Size

£152.00

SKU:: A3064
Additional Names:: PAR-6A|PAR6|PAR6alpha|PAR6C|PARD6A|TAX40|TIP-40
Application:: ELISA, WB
Molecular Weight:: 47kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADS
Uniprot:: Q9NPB6
Synonyms:: PAR-6 alpha;par-6 partitioning defective 6 homolog alpha;PAR-6A;PAR6;PAR6alpha;PAR6C;partitioning defective 6 homolog alpha;partitioning-defective protein 6;tax interaction protein 40;Tax-interacting protein 40;TAX40;TIP-40
Extra Details:: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.