A3063
PAR4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3063
- Additional Names:
- Par-4|PAR4
- Application:
- ELISA, WB
- Molecular Weight:
- 43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
- Uniprot:
- Q96IZ0
- Synonyms:
- Par-4;PAR4;PRKC apoptosis WT1 regulator protein;PRKC, apoptosis, WT1, regulator;Prostate apoptosis response 4 protein;prostate apoptosis response protein 4;prostate apoptosis response protein PAR-4;prostate apoptosis response-4;transcriptional repressor PAR4;WT1-interacting protein
- Extra Details:
- This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases.
- Shipping Conditions:
- Blue Ice

