PPAP2A Rabbit polyclonal antibody

Size

£152.00

SKU:: A3062
Additional Names:: LLP1a|LPP1|PAP-2a|PAP2|PPAP2A
Application:: ELISA, WB
Molecular Weight:: 32kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK
Uniprot:: O14494
Synonyms:: Lipid phosphate phosphohydrolase 1;lipid phosphate phosphohydrolase 1a;LLP1a;LPP1;PAP-2a;PAP2;PAP2-alpha;phosphatidate phosphohydrolase type 2a;phosphatidic acid phosphatase 2a;phosphatidic acid phosphatase type 2A;phosphatidic acid phosphohydrolase type 2a;phospholipid phosphatase 1;PPAP2A;type-2 phosphatidic acid phosphatase alpha
Extra Details:: The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.