CHRNA10 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3042
Additional Names:: CHRNA10
Application:: ELISA, WB
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
Uniprot:: Q9GZZ6
Synonyms:: acetylcholine receptor, nicotinic, alpha 10 (neuronal);cholinergic receptor, nicotinic alpha 10;cholinergic receptor, nicotinic, alpha 10 (neuronal);cholinergic receptor, nicotinic, alpha polypeptide 10;NACHR alpha-10;neuronal acetylcholine receptor subunit alpha-10;nicotinic acetylcholine receptor subunit alpha-10
Extra Details:: Predicted to enable acetylcholine-gated cation-selective channel activity. Acts upstream of or within positive regulation of cytosolic calcium ion concentration. Predicted to be located in membrane. Predicted to be active in cholinergic synapse and neuron projection. Predicted to be integral component of postsynaptic specialization membrane.