IGFBP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2981
Additional Names:: AFBP|hIGFBP-1|IBP1|IGF-BP25|IGFBP1|PP12
Application:: ELISA, WB
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Uniprot:: P08833
Synonyms:: AFBP;alpha-pregnancy-associated endometrial globulin;amniotic fluid binding protein;binding protein-25;binding protein-26;binding protein-28;growth hormone independent-binding protein;hIGFBP-1;IBP-1;IBP1;IGF-binding protein 1;IGF-BP25;IGFBP-1;insulin-like growth factor-binding protein 1;placental protein 12;PP12
Extra Details:: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients.

Shipping Conditions:: Blue Ice