HMGA2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2972
Additional Names:: BABL|HMGA2|HMGI-C|HMGIC|LIPO|SRS5|STQTL9
Application:: ELISA, WB, IHC-P
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
Uniprot:: P52926
Synonyms:: BABL;High mobility group AT-hook protein 2;high mobility group protein HMGI-C;HMGA2/KRT121P fusion;HMGI-C;HMGIC;LIPO;SRS5;STQTL9
Extra Details:: This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.