A2968
KCNH2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2968
- Additional Names:
- ERG-1|ERG1|H-ERG|HERG|HERG1|KCNH2|Kv11.1|LQT2|SQT1
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 148kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSS
- Uniprot:
- Q12809
- Synonyms:
- eag homolog;eag-related protein 1;ERG-1;ERG1;ether-a-go-go-related gene potassium channel 1;ether-a-go-go-related potassium channel protein;ether-a-go-go-related protein 1;H-ERG;HERG;HERG1;human ether-a-go-go-related;Kv11.1;long QT syndrome type 2;LQT2;potassium channel, voltage gated eag related subfamily H, member 2;potassium voltage-gated channel subfamily H member 2;potassium voltage-gated channel, subfamily H (eag-related), member 2;SQT1;voltage-gated potassium channel subunit Kv11.1
- Extra Details:
- This gene encodes a component of a voltage-activated potassium channel found in cardiac muscle, nerve cells, and microglia. Four copies of this protein interact with one copy of the KCNE2 protein to form a functional potassium channel. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified.
- Shipping Conditions:
- Blue Ice