KISS1R Rabbit polyclonal antibody

Size

£152.00

SKU:: A2967
Additional Names:: AXOR12|CPPB1|GPR54|HH8|HOT7T175|KISS-1R|KISS1R
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 40-75 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSY
Uniprot:: Q969F8
Synonyms:: AXOR12;CPPB1;G protein-coupled receptor 54;G-protein coupled receptor 54;G-protein coupled receptor OT7T175;GPR54;HH8;HOT7T175;hypogonadotropin-1;kiSS-1 receptor;KISS-1R;kisspeptins receptor;metastin receptor
Extra Details:: The protein encoded by this gene is a galanin-like G protein-coupled receptor that binds metastin, a peptide encoded by the metastasis suppressor gene KISS1. The tissue distribution of the expressed gene suggests that it is involved in the regulation of endocrine function, and this is supported by the finding that this gene appears to play a role in the onset of puberty. Mutations in this gene have been associated with hypogonadotropic hypogonadism and central precocious puberty.