A2949
GJB3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2949
- Additional Names:
- CX31|DFNA2|DFNA2B|EKV|EKVP1|GJB3
- Application:
- ELISA, WB
- Molecular Weight:
- 31kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV
- Uniprot:
- O75712
- Synonyms:
- connexin 31;Connexin-31;CX31;DFNA2;DFNA2B;EKV;EKVP1;gap junction beta-3 protein;gap junction protein, beta 3, 31kDa
- Extra Details:
- This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene can cause non-syndromic deafness or erythrokeratodermia variabilis, a skin disorder. Alternative splicing results in multiple transcript variants encoding the same protein.
- Shipping Conditions:
- Blue Ice