A2946
CLDN3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2946
- Additional Names:
- C7orf1|CLDN3|CPE-R2|CPETR2|HRVP1|RVP1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
- Uniprot:
- O15551
- Synonyms:
- C7orf1;claudin-3;Clostridium perfringens enterotoxin receptor 2;CPE-R 2;CPE-R2;CPE-receptor 2;CPETR2;HRVP1;Rat ventral prostate.1 protein homolog;RVP1;ventral prostate.1 protein homolog;ventral prostate.1-like protein
- Extra Details:
- Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat.
- Shipping Conditions:
- Blue Ice




_WB_01.jpg)

_IF_01.jpg)
_IF_02.jpg)