A2936
FST Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2936
- Additional Names:
- FS|FST
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
- Uniprot:
- P19883
- Synonyms:
- activin-binding protein;follistatin;FS
- Extra Details:
- Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
- Shipping Conditions:
- Blue Ice