A2887
Aquaporin-4 (AQP4) Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2887
- Additional Names:
- Aquaporin-4 (AQP4)|hAQP4|MIWC|WCH4
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
- Uniprot:
- P55087
- Synonyms:
- aquaporin type4;aquaporin-4;mercurial-insensitive water channel;MIWC;WCH4
- Extra Details:
- This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon.
- Shipping Conditions:
- Blue Ice