A2883
GJD2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2883
- Additional Names:
- CX36|GJA9|GJD2
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
- Uniprot:
- Q9UKL4
- Synonyms:
- connexin-36;CX36;gap junction alpha-9 protein;gap junction delta-2 protein;gap junction protein, delta 2, 36kDa;GJA9
- Extra Details:
- This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion.
- Shipping Conditions:
- Blue Ice