CCL17 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2854
Additional Names:: A-152E5.3|ABCD-2|CCL17|SCYA17|TARC
Application:: ELISA, WB
Molecular Weight:: 38-40kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Uniprot:: Q92583
Synonyms:: A-152E5.3;ABCD-2;C-C motif chemokine 17;CC chemokine TARC;chemokine (C-C motif) ligand 17;SCYA17;small inducible cytokine subfamily A (Cys-Cys), member 17;small-inducible cytokine A17;T cell-directed CC chemokine;TARC;thymus and activation-regulated chemokine
Extra Details:: This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.