PLIN5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A28371
Additional Names:: 2310076L09Rik|Lsdp5|MLDP|PAT-1
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 55 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GSVARAHACVDEFLDLVLRAMPLPWLVGPFAPILVEQSEPLINLATCVDEVVGDPDPRWAHMDWPAQKRAWEAESADPGGQEAEPPRGQGKHTMMPELDF
Uniprot:: Q8BVZ1
Synonyms:: 2310076L09Rik;AI415325;AW109675;lipid droplet associated protein;lipid droplet-associated protein PAT-1;lipid storage droplet protein 5;Ls;LSDA5;Lsdp5;ML;MLDP;myocardial LD protein;OXPAT;PAT-1;perilipin-5
Extra Details:: Enables identical protein binding activity and lipase binding activity. Involved in several processes, including negative regulation of peroxisome proliferator activated receptor signaling pathway; positive regulation of triglyceride storage; and regulation of lipid metabolic process. Located in cytosol. Colocalizes with lipid droplet. Is expressed in brown fat. Orthologous to human PLIN5 (perilipin 5).