Serotonin transporter Rabbit polyclonal antibody

Size

£152.00

SKU:: A28369
Additional Names:: 5-HTT|Htt|Sert
Application:: ELISA, WB, IHC-P
Molecular Weight:: 83 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: METTPLNSQKVLSECKDKEDCQENGVLQKGVPTPADKAGPGQISNGYSAVPSTSAGDEAPHSTPAATTTLVAEIHQGERETWGKK
Uniprot:: Q60857
Synonyms:: 5-HTT;5-HTTLPR;5-hydroxytryptamine (serotonin) transporter;5HT transporter;5HTT;AI323329;hSERT;HTT;Na+/Cl- dependent serotonin transporter;OCD1;Se;serotonin transporter 1;SERT;SERT1;sodium-dependent serotonin transporter;Sodium-dependent serotonin transporter (5HT transporter) (5HTT);solute carrier family 6 (neurotransmitter transporter, serotonin), member 4;solute carrier family 6 (neurotransmitter transporter), member 4;solute carrier family 6 member 4
Extra Details:: Enables neurotransmitter transmembrane transporter activity; nitric-oxide synthase binding activity; and serotonin:sodium:chloride symporter activity. Involved in several processes, including nervous system development; platelet aggregation; and serotonin uptake. Located in focal adhesion and synapse. Is expressed in several structures, including early conceptus; heart; liver; nervous system; and ovary. Used to study autism spectrum disorder and sudden infant death syndrome. Human ortholog(s) of this gene implicated in several diseases, including alcohol dependence; anxiety disorder (multiple); depressive disorder (multiple); heart disease (multiple); and substance abuse (multiple). Orthologous to human SLC6A4 (solute carrier family 6 member 4).

Shipping Conditions:: Blue Ice